Notes from the Slippery Slope, Part 1

The only place you'll ever hear the truth
User avatar
jelco
level5
level5
Posts: 6018
Joined: Sat Feb 18, 2006 7:45 am
Location: Cygnus X-1
Contact:

Postby jelco » Thu Jun 14, 2007 5:17 pm

I think that you exaggerated a little too much that Darwinians are lo-res graphics...

Jelco
"The ships hung in the sky much the same way that bricks don't."
- Douglas Adams
User avatar
xander
level5
level5
Posts: 16869
Joined: Thu Oct 21, 2004 11:41 pm
Location: Highland, CA, USA
Contact:

Postby xander » Thu Jun 14, 2007 5:17 pm

I'm with Rkiver. Future War. Nice homage to the roots of Darwinia, yet a good enough game to sell to wider audiences, as well.

xander
User avatar
Ace Rimmer
level5
level5
Posts: 10803
Joined: Thu Dec 07, 2006 9:46 pm
Location: The Multiverse

Postby Ace Rimmer » Thu Jun 14, 2007 5:18 pm

KingAl wrote:I'm currently only capable of thinking up lame puns like 'Metawarphasis'.

I'm dissapointed. Where's BrianBlessed, maybe he can do better... :wink:

On a serious note, I don't much care for BitWars. If I ran across it with that name I'd most likely ignore it (if I wasn't familiar with IV) as it doesn't capture the essence of the game (I think).
Smoke me a kipper, I'll be back for breakfast...
User avatar
shinygerbil
level5
level5
Posts: 4667
Joined: Wed Dec 22, 2004 10:14 pm
Location: Out, finding my own food. Also, doing the shinyBonsai Manoeuvre(tm)
Contact:

Postby shinygerbil » Thu Jun 14, 2007 5:22 pm

None of the names cut the mustard yet. Even Future War doesn't capture the essence of this new style of game - it's hardly indicative of fun and hilarity!
Here is my signature. Make of it what you will.
Image
Rkiver
level5
level5
Posts: 6405
Joined: Tue Oct 01, 2002 10:39 am
Location: Dublin, Ireland

Postby Rkiver » Thu Jun 14, 2007 5:24 pm

Well they can hardly call it "Crazy madcap strategy with lots of little Darwinians charging about while our community giggles insanely". The anacronym alone is silly. CMSWLOLDCAWOCGI. Looks Welsh.....
Uplink help: Read the FAQ
Gorans
level0
Posts: 3
Joined: Thu Jun 14, 2007 5:14 pm
Contact:

Postby Gorans » Thu Jun 14, 2007 5:24 pm

I like Bitwars but just to add to the list:

- Warwinia
- Virusus
- Pixel dissent
- .war
User avatar
jelco
level5
level5
Posts: 6018
Joined: Sat Feb 18, 2006 7:45 am
Location: Cygnus X-1
Contact:

Postby jelco » Thu Jun 14, 2007 5:24 pm

If it's about hilarity, you might choose a name like 'Matrices and Megabytes'.

Sorry. I just HAD to say it. I'll try to keep myself from posting those lame puns in the future.

Jelco
"The ships hung in the sky much the same way that bricks don't."

- Douglas Adams
User avatar
shinygerbil
level5
level5
Posts: 4667
Joined: Wed Dec 22, 2004 10:14 pm
Location: Out, finding my own food. Also, doing the shinyBonsai Manoeuvre(tm)
Contact:

Postby shinygerbil » Thu Jun 14, 2007 5:28 pm

Perhaps we should call it "darwinian rush kekekekekeke"
Here is my signature. Make of it what you will.

Image
User avatar
jelco
level5
level5
Posts: 6018
Joined: Sat Feb 18, 2006 7:45 am
Location: Cygnus X-1
Contact:

Postby jelco » Thu Jun 14, 2007 5:31 pm

Rkiver wrote:CMSWLOLDCAWOCGI. Looks Welsh.....


The longest city name I know of is Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch. As you can guess, this is Welsh. The domain could be registeredafter the restrictions on the amount of characters of web adresses were lifted. I don't think anyone will remember a website like http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com though...

You should visit the site. It has some other funny names.

Jelco
Last edited by jelco on Thu Jun 14, 2007 5:34 pm, edited 2 times in total.
User avatar
shinygerbil
level5
level5
Posts: 4667
Joined: Wed Dec 22, 2004 10:14 pm
Location: Out, finding my own food. Also, doing the shinyBonsai Manoeuvre(tm)
Contact:

Postby shinygerbil » Thu Jun 14, 2007 5:33 pm

Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwhenuakitanatahu wins, I believe ;)

edit - I don't think it' a city name, though. I do, scarily, know how to spell it. (My dad taught me the weirdest things when I was a kid...)
Here is my signature. Make of it what you will.

Image
User avatar
jelco
level5
level5
Posts: 6018
Joined: Sat Feb 18, 2006 7:45 am
Location: Cygnus X-1
Contact:

Postby jelco » Thu Jun 14, 2007 5:35 pm

Wrong. The winning name is Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit.

By the way, that name you typed is a real city name in New Zealand. The above name is a Thai town.

Jelco
"The ships hung in the sky much the same way that bricks don't."

- Douglas Adams
User avatar
BrianBlessed
level4
level4
Posts: 867
Joined: Sat Dec 24, 2005 9:33 pm

Postby BrianBlessed » Thu Jun 14, 2007 5:50 pm

"In Darwinia the wind doesn't blow, it bytes."
martin
level5
level5
Posts: 3210
Joined: Fri Nov 19, 2004 8:37 pm

Postby martin » Thu Jun 14, 2007 6:02 pm

BrianBlessed wrote:"In Darwinia the wind doesn't blow, it bytes."


oh god, stop with the puns ><

Anyway, I'm with Rkiver and xander on this, "Future War" is a good title. Or of course you could use "TheBigMod: Multiplayer" *ducks*

EDIT:: How about "Digital Nightmare"?

EDIT2:: Actually, that sounds stupid, and it has nothing to do with the game play.

EDIT3:: Or, just reading the charles darwinia post on wikipedia, how about something like "natural selection", or "unnatural selection" of course, maybe a play on that theme, "digital selection" and the like...

EDIT4:: Still reading wikipedia, how about a play on "the descent of man", something like "descent of darwinia" etc...
GENERATION 22:The first time you see this, copy it into your sig on any forum and add 1 to the generation. Social experiment.
User avatar
ynbniar
level5
level5
Posts: 2028
Joined: Wed Nov 08, 2006 10:36 pm
Location: Home again...

Postby ynbniar » Thu Jun 14, 2007 6:17 pm

FIFA 2009

You'll sell thousands... :wink:

:oops: sorry, I'll try to be serious later...
User avatar
Xocrates
level5
level5
Posts: 5262
Joined: Wed Dec 13, 2006 11:34 pm

Postby Xocrates » Thu Jun 14, 2007 6:27 pm

ynbniar wrote:FIFA 2009

You'll sell thousands... :wink:

:oops: sorry, I'll try to be serious later...


Why stop there? Go with Starcraft II.

...

Oops, nevermind, that one is Subversion :wink:



How about... Binary (R)evolution

Or maybe just (R)evolution.

Hum...


@martin: Did you know that I actually had written "Digital Selection" in one of my previous post only to delete it.

Return to “Introversion Blog”

Who is online

Users browsing this forum: No registered users and 2 guests